Iright
BRAND / VENDOR: Proteintech

Proteintech, 28819-1-AP, MEF2A Polyclonal antibody

CATALOG NUMBER: 28819-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MEF2A (28819-1-AP) by Proteintech is a Polyclonal antibody targeting MEF2A in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 28819-1-AP targets MEF2A in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, SH-SY5Y cells, THP-1 cells Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MEF2A belongs to a family of DNA binding regulatory proteins. Each of these proteins which belong to the myocyte-specific enhancer factor-2 (MEF2) family binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. MEF2A plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. MEF2A also has key roles in cardiac and skeletal muscle development. MEF2A is especially abundant in granule neurons of the cerebellar cortex throughout the period of synaptogenesis. This antibody can detect two bands around 60 kDa to 70 kDa, the larger band may correspond to its post-translational modifications.(PMID: 15483225,16484498, 23486945 ) Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30349 Product name: Recombinant human MEF2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-258 aa of BC013437 Sequence: MRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPP Predict reactive species Full Name: myocyte enhancer factor 2A Calculated Molecular Weight: 499 aa, 54 kDa Observed Molecular Weight: 50-70kDa GenBank Accession Number: BC013437 Gene Symbol: MEF2A Gene ID (NCBI): 4205 RRID: AB_3086086 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02078 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924