Iright
BRAND / VENDOR: Proteintech

Proteintech, 28869-1-AP, SARS-CoV-2 S protein (126-264 aa) Polyclonal antibody

CATALOG NUMBER: 28869-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SARS-CoV-2 S protein (126-264 aa) (28869-1-AP) by Proteintech is a Polyclonal antibody targeting SARS-CoV-2 S protein (126-264 aa) in ELISA applications with reactivity to Virus samples 28869-1-AP targets SARS-CoV-2 S protein (126-264 aa) in WB, IP, ELISA applications and shows reactivity with Virus samples. Tested Applications Positive ELISA detected in: Recombinant protein Recommended dilution Enzyme-linked Immunosorbent Assay (ELISA): ELISA : Background Information Coronaviruses (CoVs) infect human and animals and cause varieties of diseases, including respiratory, enteric, renal, and neurological diseases. CoV uses its spike protein to recognize ACE2 as its receptors and mediate membrane fusion and virus entry into host cells(PMID: 32221306). Each monomer of trimeric S protein is about 180 kDa, and contains two subunits, S1 and S2,S1 recognizes and binds to host receptors, and subsequent conformational changes in S2 facilitate fusion between the viral envelope and the host cell membrane(PMID: 19198616). Although the amino acid sequences of the S-glycoprotein were found to be different between the various HCoV, the structures showed high similarity, but the best 3D structural overlap shared by SARS-CoV and SARS-CoV-2, consistent with the shared ACE2 predicted receptor (PMID: 32522207). The spike protein of CoVs can be a target for vaccine and therapeutic development (PMID: 19198616). 28869-1-AP is specific for spike protein of SARS-COV-2, that antigen region is 126-264aa. Specification Tested Reactivity: Virus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30679 Product name: Recombinant virus spike protein protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-264 aa of NC_045512 Sequence: VVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAA Predict reactive species Full Name: SARS-CoV-2 Spike Protein Calculated Molecular Weight: 141 kDa GenBank Accession Number: NC_045512 Gene Symbol: SARS-COV-2 Gene ID (NCBI): 43740568 RRID: AB_2881225 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924