Iright
BRAND / VENDOR: Proteintech

Proteintech, 28886-1-AP, ENPP1 Polyclonal antibody

CATALOG NUMBER: 28886-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ENPP1 (28886-1-AP) by Proteintech is a Polyclonal antibody targeting ENPP1 in WB, ELISA applications with reactivity to human samples 28886-1-AP targets ENPP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ENPP1, also known as PC1 or PC-1, is a type II transmembrane glycoprotein that serves as a critical enzymatic gatekeeper at the interface of cellular metabolism, mineral homeostasis, and immune signaling. It plays a crucial role in bone mineralization and soft tissue calcification, through hydrolyzing high-energy phosphate bonds to produce inorganic pyrophosphate (PPi), a potent inhibitor of ectopic mineral deposition (PMID: 37871131, PMID: 30799235, PMID: 40535334). ENPP1 inhibition protects cGAMP and ATP and reduces adenosine levels in the tumor microenvironment, activates antigen-presenting cells and increases T-cell infiltration promoting anticancer immunity (PMID: 40410143). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30355 Product name: Recombinant human ENPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 788-873 aa of BC059375 Sequence: DTSQTPLHCENLDTLAFILPHRTDNSESCVHGKHDSSWVEELLMLHRARITDVEHITGLSFYQQRKEPVSDILKLKTHLPTFSQED Predict reactive species Full Name: ectonucleotide pyrophosphatase/phosphodiesterase 1 Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 103-130 kDa GenBank Accession Number: BC059375 Gene Symbol: ENPP1 Gene ID (NCBI): 5167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22413 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924