Proteintech, 28904-1-AP, SARS-CoV-2 Envelope Protein Polyclonal antibody

Size: 20ul / 150ul The SARS-CoV-2 Envelope Protein (28904-1-AP) by Proteintech is a Polyclonal antibody targeting SARS-CoV-2 Envelope Protein in ELISA applications with reactivity to virus samples 28904-1-AP targets SARS-CoV-2 Envelope Protein in WB, IF, ELISA applications and shows reactivity with virus samples. Tested Applications Positive ELISA detected in: Recombinant protein Recommended dilution Enzyme-linked Immunosorbent Assay (ELISA): ELISA : Background Information Envelope protein of coronaviruses is a structural protein existing in both monomeric and homopentameric form. It is a minor component of the virus membrane though it is deemed to be important for many stages including virus infection, replication, dissemination and immune response stimulation. Sequence comparison has shown that this protein is identical to the counterparts of specific Bat and Pangolin coronavirus isolates, even though the Sars-CoV-2 sequence seems to possess specific modifications and characteristics with respect to other Sars CoVs(PMID:32596311). The SARS-CoV-2 envelope protein provide a strategy to assess cross-protection against COVID-19 (PMID: 32446902). Specification Tested Reactivity: virus Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30690 Product name: Recombinant virus 2019-nCOV envelope protein protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of NC_045512 Sequence: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV Predict reactive species Full Name: COVID-19 E Protein GenBank Accession Number: NC_045512 Gene Symbol: SARS-CoV-2 Envelope Protein Gene ID (NCBI): 43740570 RRID: AB_2881232 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0DTC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.