Proteintech, 29022-1-AP, APAF1 Polyclonal antibody

Size: 20ul / 150ul The APAF1 (29022-1-AP) by Proteintech is a Polyclonal antibody targeting APAF1 in WB, ELISA applications with reactivity to Human samples 29022-1-AP targets APAF1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information APAF1, also named as Apoptotic protease-activating factor 1 or KIAA0413, is a 1248 amino acid protein, which contains one CARD domain, contains one NB-ARC domain and Contains fifteen WD repeats. APAF1 localizes in the cytoplasm and is widely expressed in many tissues. Highest levels of expression is in adult spleen, peripheral blood leukocytes, in fetal brain, kidney and lung. Oligomeric APAF1 mediates the cytochrome c-dependent autocatalytic activation of pro-caspase-9 (Apaf-3), leading to the activation of caspase-3 and apoptosis. Specification Tested Reactivity: Human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30606 Product name: Recombinant human APAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 978-1110 aa of BC136532 Sequence: FGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLISSSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKDFVCHQGTVLSCDISHDATKFSSTSADKTAK Predict reactive species Full Name: apoptotic peptidase activating factor 1 Calculated Molecular Weight: 1248 aa, 142 kDa Observed Molecular Weight: 130-140 kDa GenBank Accession Number: BC136532 Gene Symbol: APAF1 Gene ID (NCBI): 317 RRID: AB_2923588 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14727 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.