Iright
BRAND / VENDOR: Proteintech

Proteintech, 29111-1-AP, MMP14 / MT1-MMP Polyclonal antibody

CATALOG NUMBER: 29111-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MMP14 / MT1-MMP (29111-1-AP) by Proteintech is a Polyclonal antibody targeting MMP14 / MT1-MMP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 29111-1-AP targets MMP14 / MT1-MMP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MMP14, also named as MT1-MMP, is a key matrix metalloproteinase (MMP) family member which plays a crucial role in tumor growth, invasion and metastasis. MT1-MMP is a cell membrane-bound proteinase, and it enhances degradation of collagen IV, a major component of the basement membrane, by forming a complex with tissue inhibitor of metalloproteinase-2 (TIMP-2) to activate pro-MMP-2. MT1-MMP can influence venous invasion, intrahepatic metastasis , and patient outcome in hepatocellular carcinoma (HCC). MT1-MMP was reported to be present in centromere and could lead to chromosome instability in MDCK cells, indicating that MT1-MMP may have more novel functions in the intracellular compartments. In western blotting, pro-MMP14 (65 kDa) and MMP14 (51 kDa) bands showed with the truncated MMP14 (45, 42, 35, 20 kDa) forms (PMID:12097451). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30755 Product name: Recombinant human MMP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-475 aa of BC064803 Sequence: PIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT Predict reactive species Full Name: matrix metallopeptidase 14 (membrane-inserted) Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 66-70 kDa GenBank Accession Number: BC064803 Gene Symbol: MMP14 Gene ID (NCBI): 4323 RRID: AB_2918236 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50281 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924