Proteintech, 29167-1-AP, TAK1 Polyclonal antibody

Size: 20ul / 150ul The TAK1 (29167-1-AP) by Proteintech is a Polyclonal antibody targeting TAK1 in WB, IHC, ELISA applications with reactivity to human samples 29167-1-AP targets TAK1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MAP3K7(Mitogen-activated protein kinase kinase kinase 7) is also named as TAK1 and belongs to the MAP kinase kinase kinase subfamily. It plays an important role in the cascades of cellular responses evoked by changes in the environment. It has been linked to interleukin-1 receptor and tumor necrosis factor receptor signaling (PMID: 16186825). It has 4 isoforms (53-55 kDa, 64-70 kDa and 75-80 kDa) produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30725 Product name: Recombinant human MAP3K7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 404-579 aa of BC017715 Sequence: GNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase 7 Calculated Molecular Weight: 579 aa, 64 kDa Observed Molecular Weight: 64-70 kDa GenBank Accession Number: BC017715 Gene Symbol: TAK1 Gene ID (NCBI): 6885 RRID: AB_2918242 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43318 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.