Proteintech, 29180-1-AP, EPB41L5 Polyclonal antibody

Size: 20ul / 150ul The EPB41L5 (29180-1-AP) by Proteintech is a Polyclonal antibody targeting EPB41L5 in WB, ELISA applications with reactivity to human samples 29180-1-AP targets EPB41L5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information EPB41L5, a member of the NBL4 subgroup of the band 4.1 superfamily, contains a FERM domain and plays an important role in regulating the connection between plasma membrane proteins and the cytoskeleton underneath the plasma membrane (PMID: 30082297). EPB41L5 is a mesenchymal-specific protein induced during EMT (epithelial-mesenchymal transition) that promotes the disruption of cell-cell adhesion kinetics (PMID: 34784520). EPB41L5 exists as four alternatively spliced isoforms encoded by a gene located on human chromosome 2q14.2. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30300 Product name: Recombinant human EPB41L5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 349-445 aa of BC032822 Sequence: GKTEYQTTKTNKARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPSISSAPVPVEIENLPQSPGTDQHDRK Predict reactive species Full Name: erythrocyte membrane protein band 4.1 like 5 Observed Molecular Weight: 58 kDa GenBank Accession Number: BC032822 Gene Symbol: EPB41L5 Gene ID (NCBI): 57669 RRID: AB_3669676 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.