Proteintech, 29185-1-AP, SULT2B1 Polyclonal antibody

Size: 20ul / 150ul The SULT2B1 (29185-1-AP) by Proteintech is a Polyclonal antibody targeting SULT2B1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 29185-1-AP targets SULT2B1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse skin tissue, LNCaP cells, MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SULT2B1 is a member of hydroxysteroid sulfotransferase (SULT) family that catalyzes sulfonation of hormones and other molecules. SULT2B1 encodes two isoforms, SULT2B1a and SULT2B1b, that differ only at their amino termini but have distinct biochemical properties as well as tissue distribution. The human fetal brain appears to only express the SULT2B1a isoform, while SULT2B1b is the predominant hydroxysteroid sulfotransferase expressed in human skin. Northern blot analysis revealed SULT2B1a has a limited tissue distribution in liver, adrenal and stomach, whereas SULT2B1b can be detected in a variety of hormone-responsive tissues including placenta, ovary, uterus, and prostate. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30209 Product name: Recombinant human SULT2B1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-365 aa of BC034694 Sequence: NHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETPHPRPS Predict reactive species Full Name: sulfotransferase family, cytosolic, 2B, member 1 Calculated Molecular Weight: 365 aa, 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC034694 Gene Symbol: SULT2B1 Gene ID (NCBI): 6820 RRID: AB_2918245 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00204 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.