Proteintech, 29186-1-AP, Serotonin transporter Polyclonal antibody

Size: 20ul / 150ul The Serotonin transporter (29186-1-AP) by Proteintech is a Polyclonal antibody targeting Serotonin transporter in WB, ELISA applications with reactivity to human, mouse samples 29186-1-AP targets Serotonin transporter in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Serotonin transporter (SERT; SLC6A4) belongs to the sodium- and chloride-dependent monoamine transporter family. SERT is a membrane transporter that terminates the neurotransmission of serotonin, a monoaminergic neurotransmitter, through its reuptake. The SERT uptake mechanism acquires energy for active transport via ATP hydrolysis or via movement against electrochemical gradients. As an oligomeric N-glycan, SERT contains disulfide bonds between cysteine residues on the second extracellular domain. Post-translational modifications regulate the uptake kinetics and membrane trafficking of SERT, in part by regulating the proper folding and assembly of SERT in a host-dependent manner (PMID: 30394319). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30412 Product name: Recombinant human SLC6A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_001045 Sequence: METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVD Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, serotonin), member 4 Calculated Molecular Weight: 70 aa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_001045 Gene Symbol: Serotonin transporter Gene ID (NCBI): 6532 RRID: AB_2935471 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31645 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.