Iright
BRAND / VENDOR: Proteintech

Proteintech, 29214-1-AP, CDK17 Polyclonal antibody

CATALOG NUMBER: 29214-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDK17 (29214-1-AP) by Proteintech is a Polyclonal antibody targeting CDK17 in WB, ELISA applications with reactivity to Human, Mouse samples 29214-1-AP targets CDK17 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, U-251 cells, mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Cyclin-dependent kinase 17 (CDK17) belongs to the protein kinase superfamily. It may play a role in terminally differentiated neurons and has a Ser/Thr-phosphorylating activity for histone H1. CDK17 can be detected as 60 kDa. Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30200 Product name: Recombinant human CDK17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_002595 Sequence: MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHEN Predict reactive species Full Name: PCTAIRE protein kinase 2 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_002595 Gene Symbol: CDK17 Gene ID (NCBI): 5128 RRID: AB_2935472 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00537 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924