Iright
BRAND / VENDOR: Proteintech

Proteintech, 29265-1-AP, MEKK2 Polyclonal antibody

CATALOG NUMBER: 29265-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MEKK2 (29265-1-AP) by Proteintech is a Polyclonal antibody targeting MEKK2 in WB, IHC, ELISA applications with reactivity to human samples 29265-1-AP targets MEKK2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MAP3K2, also named as MEKK2 and MEKK2B, belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family and MAPK kinase kinase subfamily. It is a component of a protein kinase signal transduction cascade. MAP3K2 mediates activation of the NF-kappa-B, AP1 and DDIT3 transcriptional regulators. The antibody is specific to MAP3K2. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30886 Product name: Recombinant human MAP3K2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of NM_006609 Sequence: MDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSSSPKKQNDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSR Predict reactive species Full Name: mitogen-activated protein kinase kinase kinase 2 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_006609 Gene Symbol: MAP3K2 Gene ID (NCBI): 10746 RRID: AB_2918263 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2U5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924