Proteintech, 29278-1-AP, KMT2A Polyclonal antibody

Size: 20ul / 150ul The KMT2A (29278-1-AP) by Proteintech is a Polyclonal antibody targeting KMT2A in WB, ELISA applications with reactivity to human samples 29278-1-AP targets KMT2A in WB, IF, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information KMT2A, also known as mixed-lineage leukemia (MLL), is a gene that encodes a lysine methyltransferase responsible for the transcriptional activation through lysine 4 of histone 3 (H3K4) methylation. KMT2A is expressed mainly in the nucleus and is ubiquitously present in various tissues, particularly in ovary, lymph node, endometrium, thyroid, and brain tissue. It plays a significant role in embryonic development, hematopoiesis, and neurodevelopment. Mutations in KMT2A have been associated with several pathological conditions. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30468 Product name: Recombinant human MLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3520-3670 aa of NM_001197104 Sequence: SSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLV Predict reactive species Full Name: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila) Calculated Molecular Weight: 432 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: NM_001197104 Gene Symbol: MLL Gene ID (NCBI): 4297 RRID: AB_2918266 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q03164 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.