Proteintech, 29283-1-AP, TPH2 Polyclonal antibody

Size: 20ul / 150ul The TPH2 (29283-1-AP) by Proteintech is a Polyclonal antibody targeting TPH2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 29283-1-AP targets TPH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TPH2 protein is a key enzyme in the synthesis of serotonin in the brain. It is mainly expressed in the brain and is responsible for converting tryptophan to 5-hydroxytryptophan, a precursor of serotonin. TPH2 plays a crucial role in regulating mood, anxiety, and stress responses. Variations in the TPH2 gene have been associated with several psychiatric disorders, including depression and bipolar disorder. Additionally, TPH2 expression can be regulated by various factors, such as hormones and environmental stimuli (PMID: 22241550, PMID: 29775696, PMID: 32119710, PMID: 40204433). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30281 Product name: Recombinant human TPH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 440-496 aa of BC114442 Sequence: DFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGI Predict reactive species Full Name: tryptophan hydroxylase 2 Calculated Molecular Weight: 490 aa, 56 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC114442 Gene Symbol: TPH2 Gene ID (NCBI): 121278 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IWU9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.