Proteintech, 29288-1-AP, DLK1 Polyclonal antibody

Size: 20ul / 150ul The DLK1 (29288-1-AP) by Proteintech is a Polyclonal antibody targeting DLK1 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 29288-1-AP targets DLK1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DLK1, also named PREF1, FA1, or pG2, is a transmembrane protein belonging to the epidermal growth factor (EGF)-like superfamily (PMID: 8095043). It contains six EGF-like repeats in the extracellular region. DLK1 is abundant in preadipocytes and regulate adipocyte differentiation negatively (PMID: 8500166). Deficiency of DLK1 gives rise to growth retardation and accelerated adiposity in mouse model. Expression of DLK1 is found in tumors with neuroendocrine features that implies DLK1 may be involved in neuroendocrine differentiation (PMID: 8095043). It has been reported overexpression of DLK1 could lead to the development of metabolic abnormalities by impairment of adipocyte function in mice (PMID: 12588883). The gene of DLK1 maps to chromosome 14q32, and encodes a 383-amino acid protein with a calculated molecular mass of 41 kDa. In preadipocytes, multiple discrete forms of DLK1 protein of 45-60 kDa are present, owing in part to N-linked glycosylation (PMID: 8500166). Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30916 Product name: Recombinant human DLK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 242-383 aa of BC007741 Sequence: LTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI Predict reactive species Full Name: delta-like 1 homolog (Drosophila) Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC007741 Gene Symbol: DLK1 Gene ID (NCBI): 8788 RRID: AB_2918271 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P80370 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.