Proteintech, 29311-1-AP, FOXP4 Polyclonal antibody

Size: 20ul / 150ul The FOXP4 (29311-1-AP) by Proteintech is a Polyclonal antibody targeting FOXP4 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 29311-1-AP targets FOXP4 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, PC-3 cells Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FOXP4, also named as FKHLA, belongs to the FOX family. FOXP4 has been implicated in diverse biological processes in tumor initiation and progression. It has been demonstrated that FOXP4 is significantly upregulated in breast cancer, hepatocellular carcinoma and oral squamous cell carcinoma (PMID: 34590150). FOXP4 has 3 isoforms with the molecular mass of 72-73 kDa. Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29953 Product name: Recombinant human FOXP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 560-678 aa of BC052803 Sequence: ISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS Predict reactive species Full Name: forkhead box P4 Calculated Molecular Weight: 678 aa, 73 kDa Observed Molecular Weight: 73 kDa GenBank Accession Number: BC052803 Gene Symbol: FOXP4 Gene ID (NCBI): 116113 RRID: AB_2918279 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVH2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.