Proteintech, 29316-1-AP, CDCA5 Polyclonal antibody

Size: 20ul / 150ul The CDCA5 (29316-1-AP) by Proteintech is a Polyclonal antibody targeting CDCA5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 29316-1-AP targets CDCA5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, LNCaP cells, U2OS cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human cell division cycle associated 5 (CDCA5), also known as Sororin, is required for stable binding of cohesin to chromatid in the S and G2/M phases and degraded through anaphase-promoting complex-dependent ubiquitination in the G0/G1 phase (PMID: 30808873). Suppression of CDCA5 expression with siRNAs inhibited the growth of lung cancer cells. CDCA5 positivity is an independent prognostic factor for lung cancer patients (PMID: 20551060). The predicted molecular size of CDCA is 27 kd, with an electrophoretic mobility of ~35 kd on SDS-PAGE, possibly due to its isoelectric point (pI) of approximately 10 (PMID: 22580470). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30966 Product name: Recombinant human CDCA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 120-252 aa of BC011000 Sequence: PEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE Predict reactive species Full Name: cell division cycle associated 5 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27~35 kDa GenBank Accession Number: BC011000 Gene Symbol: CDCA5 Gene ID (NCBI): 113130 RRID: AB_3086115 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96FF9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.