Iright
BRAND / VENDOR: Proteintech

Proteintech, 29317-1-AP, ZNF664 Polyclonal antibody

CATALOG NUMBER: 29317-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF664 (29317-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF664 in IP, ELISA applications with reactivity to human, mouse samples 29317-1-AP targets ZNF664 in IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse liver tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30992 Product name: Recombinant human ZNF664 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-100 aa of BC101530 Sequence: WRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSS Predict reactive species Full Name: zinc finger protein 664 Calculated Molecular Weight: 261 aa, 30 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC101530 Gene Symbol: ZNF664 Gene ID (NCBI): 144348 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3J9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924