Product Description
Size: 20ul / 150ul
The ZNF664 (29317-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF664 in IP, ELISA applications with reactivity to human, mouse samples
29317-1-AP targets ZNF664 in IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IP detected in: mouse liver tissue
Recommended dilution
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag30992 Product name: Recombinant human ZNF664 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-100 aa of BC101530 Sequence: WRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSS Predict reactive species
Full Name: zinc finger protein 664
Calculated Molecular Weight: 261 aa, 30 kDa
Observed Molecular Weight: 30-35 kDa
GenBank Accession Number: BC101530
Gene Symbol: ZNF664
Gene ID (NCBI): 144348
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8N3J9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924