Iright
BRAND / VENDOR: Proteintech

Proteintech, 29318-1-AP, S1PR1/EDG1 Polyclonal antibody

CATALOG NUMBER: 29318-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The S1PR1/EDG1 (29318-1-AP) by Proteintech is a Polyclonal antibody targeting S1PR1/EDG1 in WB, ELISA applications with reactivity to human, mouse samples 29318-1-AP targets S1PR1/EDG1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information S1PR1 (sphingosine-1-phosphate receptor 1), also known as S1P1 or EDG1, is one of five G-protein-coupled receptors for sphingosine-1-phosphate (S1P) (PMID: 18787560). S1P1 and its receptors have important regulatory functions in normal physiology and disease processes, particularly involving the immune, central nervous, and cardiovascular systems (PMID: 21339489). S1PR1 is widely expressed in various cell types, including endothelial cells and lymphocytes (PMID: 14737169). S1P-S1PR1 plays a major role in lymphocyte egress and chemotaxis, cell proliferation and survival, and tumor angiogenesis and metastasis (PMID: 21102457). Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28083 Product name: Recombinant human S1PR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 311-382 aa of BC018650 Sequence: YTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS Predict reactive species Full Name: sphingosine-1-phosphate receptor 1 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC018650 Gene Symbol: S1PR1 Gene ID (NCBI): 1901 RRID: AB_2918281 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P21453 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924