Proteintech, 29324-1-AP, TFEC Polyclonal antibody

Size: 20ul / 150ul The TFEC (29324-1-AP) by Proteintech is a Polyclonal antibody targeting TFEC in WB, ELISA applications with reactivity to Human, mouse, rat samples 29324-1-AP targets TFEC in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The DNA-binding factor TFE3 contains adjacent helix-loop-helix (HLH) and leucine zipper (LZ) domains flanked by an upstream basic region. These protein motifs are frequently observed in other transcription factors and are particularly common to members of the Myc family. TFEC shares a bHLH/LZ structure with TFE3 and a closely related protein microphthalmia-associated transcription factor (MITF), which is critically involved in melanocyte differentiation. The expression of TFEC is mainly in fibroblasts, myoblasts, chondrosarcoma cells and myeloma cells. 50kDa human TFEC isoforms are produced by alternative splicing (PMID: 29303964, PMID: 11467950). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30973 Product name: Recombinant human TFEC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-197 aa of BC029891 Sequence: LPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQVFIRM Predict reactive species Full Name: transcription factor EC Calculated Molecular Weight: 347 aa, 39 kDa Observed Molecular Weight: 37-50 kDa GenBank Accession Number: BC029891 Gene Symbol: TFEC Gene ID (NCBI): 22797 RRID: AB_3086117 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14948 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.