Iright
BRAND / VENDOR: Proteintech

Proteintech, 29328-1-AP, GPR161 Polyclonal antibody

CATALOG NUMBER: 29328-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR161 (29328-1-AP) by Proteintech is a Polyclonal antibody targeting GPR161 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 29328-1-AP targets GPR161 in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: ARPE-19 cells, hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GPR161 (also known as RE2) is an orphan G protein-coupled receptor and plays an important role in the Hh pathway. In the absence of Hh signals, GPR161 localizes to primary cilia and keeps the downstream GLI transcription factors in their repressor forms (PMID: 26305592). Ciliary localization of GPR161 requires TULP3 and the IFT-A complex. In the presence of SHH, GPR161 is removed from primary cilia and is internalized into recycling endosomes, preventing its activity and allowing activation of the Shh signaling. GPR161 has a calculated molecular mass of 59 kDa. The 70-kDa band detected by this antibody probably represents a modified version of GPR161 (PMID: 18250320). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30998 Product name: Recombinant human GPR161 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 362-460 aa of BC028163 Sequence: SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD Predict reactive species Full Name: G protein-coupled receptor 161 Calculated Molecular Weight: 529 aa, 59 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC028163 Gene Symbol: GPR161 Gene ID (NCBI): 23432 RRID: AB_3086118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N6U8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924