Proteintech, 29338-1-AP, FOXK1 Polyclonal antibody

Size: 20ul / 150ul The FOXK1 (29338-1-AP) by Proteintech is a Polyclonal antibody targeting FOXK1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 29338-1-AP targets FOXK1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MDA-MB-231 cells, MKN-45 cells Positive IP detected in: K-562 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SW480 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Forkhead box (FOX) domains bind DNA and consist of 2 loops connecting beta-sheets that flank an alpha-helix, which is a group of highly conserved transcription factors. Forkhead box k1 (FOXK1) also known as MNF, is a transcription factor that belongs to the forkhead family consisting of the winged-helix DNA-binding domain and the N-terminal and C-terminal transcriptional domains(PMID: 15289879, PMID: 27223064). There are two isoforms of FoxK1: FoxK1-α and FoxK1-β. FoxK1-α (90 kDa) is expressed in committed myoblasts and differentiated myotubes, while FoxK1-β (55 kDa) is expressed mainly in quiescent satellite cells(PMID: 9271401). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28820 Product name: Recombinant human FOXK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001037165 Sequence: MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPLPPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQ Predict reactive species Full Name: forkhead box K1 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: NM_001037165 Gene Symbol: FOXK1 Gene ID (NCBI): 221937 RRID: AB_3669682 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P85037 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.