Iright
BRAND / VENDOR: Proteintech

Proteintech, 29358-1-AP, SFXN5 Polyclonal antibody

CATALOG NUMBER: 29358-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFXN5 (29358-1-AP) by Proteintech is a Polyclonal antibody targeting SFXN5 in WB, ELISA applications with reactivity to Human, mouse, rat samples 29358-1-AP targets SFXN5 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information SFXN5 (Sideroflexin-5) is an astrocytic mitovesicle protein. In brown adipose tissue, it is key modulators of the widely studied thermogenic protein uncoupling protein 1 (UCP1). (PMID: 36334589, PMID: 35904699) Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16203 Product name: Recombinant human SFXN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC101312 Sequence: MADTATTASAAAASAASASSDAPPFQLGKPRFQQTSFYGRFRHFLDIIDPRTLFVTERRLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMS Predict reactive species Full Name: sideroflexin 5 Calculated Molecular Weight: 340 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC101312 Gene Symbol: SFXN5 Gene ID (NCBI): 94097 RRID: AB_3086124 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TD22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924