Iright
BRAND / VENDOR: Proteintech

Proteintech, 29361-1-AP, CD134/OX40 Polyclonal antibody

CATALOG NUMBER: 29361-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD134/OX40 (29361-1-AP) by Proteintech is a Polyclonal antibody targeting CD134/OX40 in WB, ELISA applications with reactivity to Human samples 29361-1-AP targets CD134/OX40 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: MJ cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CD134, also known as OX40 and TNFRSF4, is a member of the TNFR-superfamily of receptors (PMID: 2828930; 9766631). It is a type I transmembrane protein predominantly expressed on activated T cells which include CD4 and CD8 T cells, Th2, Th1, and Th17 cells, as well as regulatory T cells (Tregs) (PMID: 20307208). CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule (PMID: 26215166). CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmune diseases, cancer and infectious disease (PMID: 26215166; 19426222). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28521 Product name: Recombinant human TNFRSF4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-214 aa of NM_003327 Sequence: MLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 4 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: NM_003327 Gene Symbol: CD134 Gene ID (NCBI): 7293 RRID: AB_3669684 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43489 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924