Iright
BRAND / VENDOR: Proteintech

Proteintech, 29383-1-AP, EHBP1L1 Polyclonal antibody

CATALOG NUMBER: 29383-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EHBP1L1 (29383-1-AP) by Proteintech is a Polyclonal antibody targeting EHBP1L1 in WB, ELISA applications with reactivity to human, mouse, rat samples 29383-1-AP targets EHBP1L1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information EHBP1L1 is an adapter protein localized on recycling endosomes. It regulates apical-directed transport in polarized epithelial cells. Additionally, EHBP1L1 is crucial for erythroblast enucleation by promoting nuclear polarization in coordination with Rab10, Bin1, and dynamin. It also maintains the proper morphology and structural stability of erythrocytes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29796 Product name: Recombinant human EHBP1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 549-747 aa of NM_001099409 Sequence: AQGAISRGLGGWEAEAGGSGDLETETEVVGLEVLGTQEKEVEGSGFPETRTLEIEILGALEKEAARSRVLESEVAGTAQCEGLETQETEVGVIETPGTETEVLGTQKTEAGGSGVLQTRTTIAETEVLVTQEISGDLGPLKIEDTIQSEMLGTQETEVEASRVPESEAEGTEAKILGTQEITARDSGVREIEAEIAESD Predict reactive species Full Name: EH domain binding protein 1-like 1 Calculated Molecular Weight: 162 kDa Observed Molecular Weight: 162 kDa GenBank Accession Number: NM_001099409 Gene Symbol: EHBP1L1 Gene ID (NCBI): 254102 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3D4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924