Proteintech, 29392-1-AP, LMO7 Polyclonal antibody

Size: 20ul / 150ul The LMO7 (29392-1-AP) by Proteintech is a Polyclonal antibody targeting LMO7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 29392-1-AP targets LMO7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, mouse lung tissue Positive IHC detected in: mouse heart tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LMO7, also known as LOMP, FBX20, belongs to the single Calponin-homology (CH) domain-containing protein family, with a single actin-binding CH domain at the amino terminal end(PMID: 19459066). LMO7 also contains a PDZ domain and a carboxyl-terminal LIM domain, both of which have been described as protein-protein interacting domains(PMID: 15140894). LMO7 encodes three splice variants of calculated molecular weights of 196 kDa (P200), 157 kDa (P150), and 100 kDa (P100)(PMID: 26157009). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30016 Product name: Recombinant human LMO7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 695-838 aa of NM_005358 Sequence: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY Predict reactive species Full Name: LIM domain 7 Calculated Molecular Weight: 193 kDa Observed Molecular Weight: 140-160 kDa GenBank Accession Number: NM_005358 Gene Symbol: LMO7 Gene ID (NCBI): 4008 RRID: AB_3086128 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWI1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.