Proteintech, 29395-1-AP, SOX11 Polyclonal antibody

Size: 20ul / 150ul The SOX11 (29395-1-AP) by Proteintech is a Polyclonal antibody targeting SOX11 in WB, ELISA applications with reactivity to Human samples 29395-1-AP targets SOX11 in WB, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: fetal human brain tissue, Y79 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30020 Product name: Recombinant human SOX11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-310 aa of NM_003108 Sequence: KMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSR Predict reactive species Full Name: SRY (sex determining region Y)-box 11 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_003108 Gene Symbol: SOX11 Gene ID (NCBI): 6664 RRID: AB_2918291 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35716 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.