Proteintech, 29402-1-AP, IER3IP1 Polyclonal antibody

Size: 20ul / 150ul The IER3IP1 (29402-1-AP) by Proteintech is a Polyclonal antibody targeting IER3IP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 29402-1-AP targets IER3IP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag28027 Product name: Recombinant human IER3IP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC010888 Sequence: MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG Predict reactive species Full Name: immediate early response 3 interacting protein 1 Calculated Molecular Weight: 82 aa, 9 kDa Observed Molecular Weight: 9 kDa GenBank Accession Number: BC010888 Gene Symbol: IER3IP1 Gene ID (NCBI): 51124 RRID: AB_2918295 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5U9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.