Proteintech, 29413-1-AP, UBQLN4 Polyclonal antibody

Size: 20ul / 150ul The UBQLN4 (29413-1-AP) by Proteintech is a Polyclonal antibody targeting UBQLN4 in WB, IHC, ELISA applications with reactivity to Human samples 29413-1-AP targets UBQLN4 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: BGC-823 cells, BxPC-3 cells, HeLa cells, MKN-45 cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ubiquilins (UBQLNs) are important factors for cell proteostasis maintenance. UBQLNs are involved in the modulation of the cell cycle, as well as in apoptosis, membrane receptors regulation, DNA repair, epithelial-mesenchymal transition, and miRNA activities. Ubiquilin 4 (UBQLN4) is an important member of the ubiquitin-like protein family. UBQLN4 is overexpressed in aggressive tumors and inhibits homologous recombination, redirecting doublestrand break repair to nonhomologous end joining, resulting in increased genome instability and inducing carcinogenesis. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29658 Product name: Recombinant human UBQLN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-186 aa of BC063841 Sequence: IKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSRRSSGGGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFMELQQQMQ Predict reactive species Full Name: ubiquilin 4 Calculated Molecular Weight: 601 aa, 64 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC063841 Gene Symbol: UBQLN4 Gene ID (NCBI): 56893 RRID: AB_3086129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRR5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.