Proteintech, 29416-1-AP, NHLRC2 Polyclonal antibody

Size: 20ul / 150ul The NHLRC2 (29416-1-AP) by Proteintech is a Polyclonal antibody targeting NHLRC2 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 29416-1-AP targets NHLRC2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: U-251 cells, mouse spleen tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30159 Product name: Recombinant human NHLRC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-200 aa of NM_198514 Sequence: QKVDGWEQDLSVPEFPEGLEWLNTEEPISVYKDLCGKIVVLDFFTYCCINCIHLLPDLHALEHTYSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQELEVSCWPTLVILGPRGNMLFSLIGEGHKDKLFLYTSIALKYYKD Predict reactive species Full Name: NHL repeat containing 2 Calculated Molecular Weight: 79 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: NM_198514 Gene Symbol: NHLRC2 Gene ID (NCBI): 374354 RRID: AB_2918302 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NBF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.