Proteintech, 29445-1-AP, ATG16L1 Polyclonal antibody

Size: 20ul / 150ul The ATG16L1 (29445-1-AP) by Proteintech is a Polyclonal antibody targeting ATG16L1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 29445-1-AP targets ATG16L1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, HepG2 cells, HSC-T6 cells, HEK-293 cells, MCF-7 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Human ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 66 kDa; and Atg16L1β, 68 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31318 Product name: Recombinant human ATG16L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC000061 Sequence: NKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLS Predict reactive species Full Name: ATG16 autophagy related 16-like 1 (S. cerevisiae) Calculated Molecular Weight: 607 aa, 68 kDa Observed Molecular Weight: 68-75 kDa GenBank Accession Number: BC000061 Gene Symbol: ATG16L1 Gene ID (NCBI): 55054 RRID: AB_2918308 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q676U5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.