Iright
BRAND / VENDOR: Proteintech

Proteintech, 29474-1-AP, WEE1 Polyclonal antibody

CATALOG NUMBER: 29474-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WEE1 (29474-1-AP) by Proteintech is a Polyclonal antibody targeting WEE1 in WB, ELISA applications with reactivity to Human, mouse samples 29474-1-AP targets WEE1 in WB, IF, CoIP, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, nouse brain tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information WEE1 kinase is a serine-threonine kinase that regulates G2/M checkpoint transition. WEE1 triggers G2/M arrest through inhibitory phosphorylation on Tyr15 of CDK1 (Cdc2) and preventing entry into mitosis to allow DNA repair during DNA damage (PMID: 27427153).The predicted native molecular weight for Wee1 based on the intact human Wee1 cDNA sequence is 72 kDa, whereas the 95-110 kDa protein is a highly modified product (PMID: 7568188). Others have shown that Wee1 is 70-72 kDa and 49-55 kDa (PMID: 12214061). Specification Tested Reactivity: Human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30194 Product name: Recombinant human WEE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 515-646 aa of BC051831 Sequence: PLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTSRLIGKKMNRSVSLTIY Predict reactive species Full Name: WEE1 homolog (S. pombe) Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 72 kDa,110 kDa GenBank Accession Number: BC051831 Gene Symbol: WEE1 Gene ID (NCBI): 7465 RRID: AB_2918314 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30291 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924