Iright
BRAND / VENDOR: Proteintech

Proteintech, 29497-1-AP, CRMP1 Polyclonal antibody

CATALOG NUMBER: 29497-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRMP1 (29497-1-AP) by Proteintech is a Polyclonal antibody targeting CRMP1 in WB, IHC, ELISA applications with reactivity to Mouse, Rat samples 29497-1-AP targets CRMP1 in WB, IHC, ELISA applications and shows reactivity with Mouse, Rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of five cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62-kDa protein and its 75-kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors. Specification Tested Reactivity: Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31559 Product name: Recombinant human CRMP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-537 aa of NM_001014809 Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS Predict reactive species Full Name: collapsin response mediator protein 1 Calculated Molecular Weight: 62KD Observed Molecular Weight: 62 kDa GenBank Accession Number: NM_001014809 Gene Symbol: CRMP1 Gene ID (NCBI): 1400 RRID: AB_2918317 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14194 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924