Iright
BRAND / VENDOR: Proteintech

Proteintech, 29593-1-AP, PDIR Polyclonal antibody

CATALOG NUMBER: 29593-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PDIR (29593-1-AP) by Proteintech is a Polyclonal antibody targeting PDIR in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 29593-1-AP targets PDIR in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells, HepG2 cells, mouse liver tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PDIR(Protein disulfide isomerase-related protein), also known as PDIA5 (Protein Disulfide Isomerase Family A Member 5), is a member of the PDI gene family and also exhibits chaperone-like activity. PDIR protein is correlated with immune infiltration, which is highly expressed in glioma and participates in glioma progression(PMID: 33664747). PDIR contributes to disulfide bond rearrangement in ATF6α under stress conditions that necessary for ATF6α activation upon ER stress(PMID: 24636989). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31479 Product name: Recombinant human PDIA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-170 aa of BC001625 Sequence: SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEE Predict reactive species Full Name: protein disulfide isomerase family A, member 5 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC001625 Gene Symbol: PDIR Gene ID (NCBI): 10954 RRID: AB_2918329 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14554 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924