Iright
BRAND / VENDOR: Proteintech

Proteintech, 29623-1-AP, SH3BP4 Polyclonal antibody

CATALOG NUMBER: 29623-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SH3BP4 (29623-1-AP) by Proteintech is a Polyclonal antibody targeting SH3BP4 in WB, ELISA applications with reactivity to Human, Mouse , Rat samples 29623-1-AP targets SH3BP4 in WB, ELISA applications and shows reactivity with Human, Mouse , Rat samples. Tested Applications Positive WB detected in: HepG2 cells, MCF-7 cells, mouse lung tissue, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: Human, Mouse , Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31221 Product name: Recombinant human SH3BP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC057396 Sequence: MAAQRIRAANSNGLPRCKSEGTLIDLSEGFSETSFNDIKVPSPSALLVDNPTPFGNAKEVIAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELELLGGWTDDKKVPGRMYSNNPFWNGVQTNPFLNGNVPVMPSLDELNPKSTVDLL Predict reactive species Full Name: SH3-domain binding protein 4 Calculated Molecular Weight: 963 aa, 108 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC057396 Gene Symbol: SH3BP4 Gene ID (NCBI): 23677 RRID: AB_2918333 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P0V3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924