Iright
BRAND / VENDOR: Proteintech

Proteintech, 29654-1-AP, FRAS1 Polyclonal antibody

CATALOG NUMBER: 29654-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FRAS1 (29654-1-AP) by Proteintech is a Polyclonal antibody targeting FRAS1 in WB, ELISA applications with reactivity to Human, mouse samples 29654-1-AP targets FRAS1 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information FRAS1 (extracellular matrix organizing protein FRAS1) is required for the regulation of epidermal-basement membrane adhesion responsible for proper organogenesis during embryonic development, and it is also involved in brain organization and function. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31229 Product name: Recombinant human FRAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-388 aa of NM_025074 Sequence: CICDRGEVRCHKQACLPLRCGKGQSRARRHGQCCEECVSPAGSCSYDGVVRYQDEMWKGSACEFCMCDHGQVTCQTGECAKVECARDEELIHLDGKCCPECISRNGYCVYEETGEFMSSNASEVKRIPEGEKWEDGPCKVCECRGAQ Predict reactive species Full Name: Fraser syndrome 1 Calculated Molecular Weight: 443 kDa Observed Molecular Weight: 450-500 kDa GenBank Accession Number: NM_025074 Gene Symbol: FRAS1 Gene ID (NCBI): 80144 RRID: AB_3086149 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86XX4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924