Proteintech, 29685-1-AP, HTR3A Polyclonal antibody

Size: 20ul / 150ul The HTR3A (29685-1-AP) by Proteintech is a Polyclonal antibody targeting HTR3A in WB, ELISA applications with reactivity to human, mouse samples 29685-1-AP targets HTR3A in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information HTR3A (5-hydroxytryptamine receptor 3A, 5-HT3A) belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (5-HT, serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. So far, five distinct 5-HT3 receptor subunits (A-E) have been identified. HTR3A can form functional homomers or heteromers with HTR3B or HTR3C or HTR3D or HTR3E. 5-HT3 receptors are capable of mediating fast excitatory neurotransmission in the CNS and peripheral nervous system (PNS). (PMID: 23038271; 17073663) Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31317 Product name: Recombinant human HTR3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-132 aa of BC002354 Sequence: RRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSP Predict reactive species Full Name: 5-hydroxytryptamine (serotonin) receptor 3A Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC002354 Gene Symbol: HTR3A Gene ID (NCBI): 3359 RRID: AB_2918338 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46098 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.