Proteintech, 29728-1-AP, ICK Polyclonal antibody

Size: 20ul / 150ul The ICK (29728-1-AP) by Proteintech is a Polyclonal antibody targeting ICK in IP, ELISA applications with reactivity to human samples 29728-1-AP targets ICK in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: PC-3 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ICK is involved in the control of ciliary length, it may play a key role in the development of multiple organ systems and particularly in cardiac development. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30240 Product name: Recombinant human ICK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-495 aa of BC136420 Sequence: VGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRY Predict reactive species Full Name: intestinal cell (MAK-like) kinase Observed Molecular Weight: 71 kDa GenBank Accession Number: BC136420 Gene Symbol: ICK Gene ID (NCBI): 22858 RRID: AB_3669694 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPZ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.