Iright
BRAND / VENDOR: Proteintech

Proteintech, 29761-1-AP, NHE1 Polyclonal antibody

CATALOG NUMBER: 29761-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NHE1 (29761-1-AP) by Proteintech is a Polyclonal antibody targeting NHE1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 29761-1-AP targets NHE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse heart tissue, rat brain tissue, rat heart tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NHE1, also named as SLC9A1, encodes an Na+/H+ antiporter that is a membrane-bound enzyme involved in regulating pH of vertebrate cells. NHE1 regulates a number of cell behaviors, including adhesion, shape determination, migration, and proliferation (PMID:11807182). It is inhibited by the non-specific diuretic drug amiloride and activated by growth factors, mitogens, neurotransmitters, tumor promoters, and others (PMID: 2846238). NHE1 is expressed in heart where it contributes to cardiomyocyte pH homeostasis (PMID: 12832126, PMID: 23709596). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31192 Product name: Recombinant human NHE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 656-815 aa of NM_003047 Sequence: ADPYEEAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITIDPASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ Predict reactive species Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 1 Calculated Molecular Weight: 91 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: NM_003047 Gene Symbol: NHE1 Gene ID (NCBI): 6548 RRID: AB_2923605 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19634 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924