Proteintech, 29762-1-AP, KCNK12 Polyclonal antibody

Size: 20ul / 150ul The KCNK12 (29762-1-AP) by Proteintech is a Polyclonal antibody targeting KCNK12 in WB, ELISA applications with reactivity to Human, mouse samples 29762-1-AP targets KCNK12 in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Potassium channel, subfamily K, member 12, also known as KCNK12, is a potassium channel containing two pore-forming P domains. The product of this gene has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity. The calculated MW is 49 kDa, 29762-1-AP can detect a band around 49 kDa. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31561 Product name: Recombinant human KCNK12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 302-430 aa of NM_022055 Sequence: IKQVLNWMLRKLSCRCCARCCPAPGAPLARRNAITPGSRLRRRLAALGADPAARDSDAEGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGFSGGVGALGIMNNRLAETSASR Predict reactive species Full Name: potassium channel, subfamily K, member 12 Calculated Molecular Weight: 47KD Observed Molecular Weight: 49 kDa GenBank Accession Number: NM_022055 Gene Symbol: KCNK12 Gene ID (NCBI): 56660 RRID: AB_3086156 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HB15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.