Proteintech, 29767-1-AP, Claudin 5 Polyclonal antibody

Size: 20ul / 150ul The Claudin 5 (29767-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 5 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 29767-1-AP targets Claudin 5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: unboiled mouse lung tissue, unboiled rat lung tissue Positive IHC detected in: human colon tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 27 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag29044 Product name: Recombinant human CLDN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-218 aa of BC032363 Sequence: VREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV Predict reactive species Full Name: claudin 5 Calculated Molecular Weight: 218 aa, 23 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC032363 Gene Symbol: CLDN5 Gene ID (NCBI): 7122 RRID: AB_2935477 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00501 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.