Iright
BRAND / VENDOR: Proteintech

Proteintech, 29793-1-AP, WNT5A/B Polyclonal antibody

CATALOG NUMBER: 29793-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WNT5A/B (29793-1-AP) by Proteintech is a Polyclonal antibody targeting WNT5A/B in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 29793-1-AP targets WNT5A/B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, HeLa cells, MCF-7 cells, SKOV-3 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The WNT gene family consists of structurally related genes which encode secreted signaling proteins. There are 19 Wnt genes in the human genome that encode functionally distinct Wnt proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt members bind to the Frizzled family of seven-pass transmembrane proteins and activate several signaling pathway. Wnt5A is a member of the Wnt family of proteins, which are 38-45 kDa secreted cysteine-rich proteins with hydrophobic signal peptides. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31507 Product name: Recombinant human WNT5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-380 aa of BC064694 Sequence: EGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK Predict reactive species Full Name: wingless-type MMTV integration site family, member 5A Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC064694 Gene Symbol: WNT5A Gene ID (NCBI): 7474 RRID: AB_3086163 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924