Proteintech, 29795-1-AP, Claudin 7 Polyclonal antibody

Size: 20ul / 150ul The Claudin 7 (29795-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 7 in IHC, ELISA applications with reactivity to Human samples 29795-1-AP targets Claudin 7 in WB, IHC, IF, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human colon tissue, mouse colon tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 27 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Specification Tested Reactivity: Human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31706 Product name: Recombinant human CLDN7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-211 aa of BC001055 Sequence: NPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV Predict reactive species Full Name: claudin 7 Calculated Molecular Weight: 22.4 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC001055 Gene Symbol: Claudin 7 Gene ID (NCBI): 1366 RRID: AB_2935481 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95471 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.