Proteintech, 29803-1-AP, RGS12 Polyclonal antibody

Size: 20ul / 150ul The RGS12 (29803-1-AP) by Proteintech is a Polyclonal antibody targeting RGS12 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 29803-1-AP targets RGS12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, A431 cells, SH-SY5Y cells, THP-1 cells, NIH/3T3 cells Positive IHC detected in: rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Regulator of G-protein signaling 12 (RGS12) regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. This antibody can be detected as 140-150 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30731 Product name: Recombinant human RGS12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 833-962 aa of NM_198229 Sequence: LAEVEGRALPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRTRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKATK Predict reactive species Full Name: regulator of G-protein signaling 12 Calculated Molecular Weight: 156 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: NM_198229 Gene Symbol: RGS12 Gene ID (NCBI): 6002 RRID: AB_2935482 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14924 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.