Iright
BRAND / VENDOR: Proteintech

Proteintech, 29808-1-AP, SPINK5 Polyclonal antibody

CATALOG NUMBER: 29808-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPINK5 (29808-1-AP) by Proteintech is a Polyclonal antibody targeting SPINK5 in WB, ELISA applications with reactivity to Human samples 29808-1-AP targets SPINK5 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30432 Product name: Recombinant human SPINK5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-200 aa of NM_001127698 Sequence: KNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMILEKEAKSQKRARHLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAEL Predict reactive species Full Name: serine peptidase inhibitor, Kazal type 5 Calculated Molecular Weight: 121 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: NM_001127698 Gene Symbol: SPINK5 Gene ID (NCBI): 11005 RRID: AB_3086168 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ38 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924