Iright
BRAND / VENDOR: Proteintech

Proteintech, 29817-1-AP, CCDC39 Polyclonal antibody

CATALOG NUMBER: 29817-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC39 (29817-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC39 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 29817-1-AP targets CCDC39 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CCDC39 (Coiled-coil domain-containing protein 39) is an axonemal protein whose absence results in failure to correctly assemble DNALI1-containing inner dynein arm complexes, the DRC (dynein regulatory complex) and the radial spokes, thereby causing axonemal disorganization and dyskinetic beating. Alternatively, CCDC39 could participate in the transport of the inner dynein arms and DRC (PMID: 21131972). Its calculated molecular weight and observed molecular weight are both 110kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31067 Product name: Recombinant human CCDC39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-172 aa of NM_181426 Sequence: ANEENKLLEDQLSKLKDERASLQDELREYEERINSMTSHFKNVKQELSITQSLCKARERETESEEHFKAIAQRELGRVKDEIQRLENEMASILEKKSDKENGIFKATQKLDGLKCQMNWDQQALEAWLEESAHKDSDALTLQKYAQQDDNKIR Predict reactive species Full Name: coiled-coil domain containing 39 Calculated Molecular Weight: 110 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: NM_181426 Gene Symbol: CCDC39 Gene ID (NCBI): 339829 RRID: AB_3086172 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UFE4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924