Proteintech, 29819-1-AP, CX3CR1 Polyclonal antibody

Size: 20ul / 150ul The CX3CR1 (29819-1-AP) by Proteintech is a Polyclonal antibody targeting CX3CR1 in WB, IF-P, ELISA applications with reactivity to human, mouse samples 29819-1-AP targets CX3CR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, THP-1 cells, Caco-2 cells Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CX3CR1, also known as GPR13, V28 and fractalkine receptor, belongs to the 7-transmembrane G protein-coupled receptor (GPCR) family. It is expressed on microglia, astrocytes, NK cells, monocytes/macrophages, and a subpopulation of T cells. CX3CR1 is the receptor for fractalkine (CX3CL1) and mediates both its adhesive and migratory functions. It also acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro), and some variations in the gene of CX3CR1 lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Defects in CX3CR1 are a cause of susceptibility to age-related macular degeneration type 12 (ARMD12). The two CX3CR1 bands exhibited can be attributed to various factors (PMID: 30628679). Specification Tested Reactivity: human, mouse Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27698 Product name: Recombinant human CX3CR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 56-231 aa of BC028078 Sequence: LTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIK Predict reactive species Full Name: chemokine (C-X3-C motif) receptor 1 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40 kDa, 44 kDa GenBank Accession Number: BC028078 Gene Symbol: CX3CR1 Gene ID (NCBI): 1524 RRID: AB_3086173 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49238 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.