Product Description
Size: 20ul / 150ul
The RALGAPA2 (29843-1-AP) by Proteintech is a Polyclonal antibody targeting RALGAPA2 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples
29843-1-AP targets RALGAPA2 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.
Tested Applications
Positive WB detected in: HeLa cells, HUVEC cells, mouse testis tissue
Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: Human, Mouse
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag31460 Product name: Recombinant human C20orf74 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1470-1610 aa of NM_020343 Sequence: YSWDGKVLYGPLEGCLAPNGRNPSFLISSWHRDTFGPQKDSSQVEEGDDVLDKLLENIGHTSPECLLPSQLNLNEPSLTPCGMNYDQEKEIIEVILRQNAQEDEYIQSHNFDSAMKVTSQGQPSPVEPRGPFYFCRLLLDD Predict reactive species
Full Name: chromosome 20 open reading frame 74
Calculated Molecular Weight: 211KD
Observed Molecular Weight: 230 kDa
GenBank Accession Number: NM_020343
Gene Symbol: RALGAPA2
Gene ID (NCBI): 57186
RRID: AB_2923613
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q2PPJ7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924