Proteintech, 29847-1-AP, GARNL1 Polyclonal antibody

Size: 20ul / 150ul The GARNL1 (29847-1-AP) by Proteintech is a Polyclonal antibody targeting GARNL1 in WB, IF/ICC, ELISA applications with reactivity to Human samples 29847-1-AP targets GARNL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GARNL1/RalGAPα1, a major α subunit of the Ral-GTPase activating protein in skeletal muscle, as a protein whose phosphorylation and binding to the regulatory 14-3-3 proteins is stimulated by insulin and also by muscle contraction (PMID:24768767).The 100 kDa band maybe an isoform or fragment (BAA74907, 943aa). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31518 Product name: Recombinant human GARNL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 680-820 aa of NM_014990.3 Sequence: LDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEETGNEVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSQK Predict reactive species Full Name: GTPase activating Rap/RanGAP domain-like 1 Calculated Molecular Weight: 230KD Observed Molecular Weight: 250 kDa GenBank Accession Number: NM_014990.3 Gene Symbol: GARNL1 Gene ID (NCBI): 253959 RRID: AB_3086178 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6GYQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.