Proteintech, 29907-1-AP, TRIM69 Polyclonal antibody

Size: 20ul / 150ul The TRIM69 (29907-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM69 in WB, IHC, ELISA applications with reactivity to Human, Mouse samples 29907-1-AP targets TRIM69 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: K-562 cells, SH-SY5Y cells Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information E3 ubiquitin-protein ligase TRIM69 (TRIM69) plays an important role in antiviral immunity by restricting different viral infections including dengue virus or vesicular stomatitis Indiana virus (PubMed:31375575, PubMed:31578292). It plays also a role in cataract formation together with TP53 (PubMed:30844644). Mechanistically, inhibits UVB-induced cell apoptosis and reactive oxygen species (ROS) production by inducing TP53 ubiquitination (PubMed:30844644). It has 4 isoforms with molecular weights of 57, 39, 34, and 32 kDa. Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag31775 Product name: Recombinant human TRIM69 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC033314 Sequence: MEEELAIQQGQLETTLKELQTLRNMQKEAIAAHKENKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQEQCLLAKDMLVSIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGPIQYMVWREMQDTLCPGLSPLTLDPKTAHPNLVLSKSQTSVWHGD Predict reactive species Full Name: tripartite motif-containing 69 Calculated Molecular Weight: 500 aa, 57 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC033314 Gene Symbol: TRIM69 Gene ID (NCBI): 140691 RRID: AB_2935487 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.